About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home Products

growth hormone peptides

I'm Online Chat Now

growth hormone peptides

China Pharmaceutical Acetyl Hexapeptide , Strong Efficient Growth Hormone Peptides factory

Pharmaceutical Acetyl Hexapeptide , Strong Efficient Growth Hormone Peptides

High Quality Cosmetic Peptide Anti Wrinkle Glutamyl Acetyl Hexapeptide-1 Product Decription Quick details: Polypeptides: Name:Glutamyl acetyl hexapeptide -1 Customized: Customized Suitable for: Adult Purity: ... Read More
2017-09-27 10:11:01
China High Efficient Tripeptide 1 Powder , Healthy Human Growth Hormone Peptide factory

High Efficient Tripeptide 1 Powder , Healthy Human Growth Hormone Peptide

Raw Powder Anti-Wrinkle Polypeptides Palmitoyl Myristoyl Tripeptide-1 Product Decription Polypeptides: Name: Myristoyl Tripeptide-1 Customized: Customized Suitable for: Adult Purity: >99% Usage: Pharmaceutical ... Read More
2017-09-27 10:11:01
China Weight Loss Pharmaceutical Grade Peptides White Freeze Dried Ghrp 2 Powder factory

Weight Loss Pharmaceutical Grade Peptides White Freeze Dried Ghrp 2 Powder

Basic Info. Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular Formula: C45H55N9O6 Molar Mass: 817.9 CAS number: 158861-67-7 PubChem: CID 6918245 Synonyms: Growth Hormone Releasing Peptide-2; GHRP2; GHRP ... Read More
2017-09-27 10:11:01
China CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding factory

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN... Read More
2017-09-27 10:11:01
China Safety Peptide Ghrp 6 Powder , Reliable Peptide Injections Bodybuilding factory

Safety Peptide Ghrp 6 Powder , Reliable Peptide Injections Bodybuilding

Injectable Human Ghrp-6 Peptides Hormone Ghrp 6 for Bodybuilding Basic Info. Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Molecular Formula: C46H56N12O6 Molar Mass: 873.014 CAS number: 87616-84-0 PubChem: 5486806 ... Read More
2017-09-27 10:11:01
China Rleasing Sermorelin Peptide powder Hormone Ghrh for Bodybuilding 2mg factory

Rleasing Sermorelin Peptide powder Hormone Ghrh for Bodybuilding 2mg

Rleasing Sermorelin Peptide powder Hormone Ghrh for Bodybuilding 2mg Product Decription Quick details: Product Name ghrh Chemical Name Sermorelin Acetate,GRF 1-29, CAS Number 86168-78-7 Molecular Formula ... Read More
2017-09-27 10:11:01
China Most Powerful Igf 1 Des 1mg , SGS Peptides For Muscle Growth 1mg / Vial factory

Most Powerful Igf 1 Des 1mg , SGS Peptides For Muscle Growth 1mg / Vial

Polypeptides Specifications: 1mg/vial, 10vial/box Intriduction IGF 1 DES comes from the IGF 1 family of peptides that play important roles in mammalian growth and development. IGF1 mediates many of the growth... Read More
2017-09-27 10:11:01
China Human Growth Peptide Tesamorelin CAS:901758-09-6 for Fat Loss factory

Human Growth Peptide Tesamorelin CAS:901758-09-6 for Fat Loss

Human Growth Peptide Tesamorelin CAS:901758-09-6 for Fat Loss Product Decription Quick details: Product name :Tesamorelin Other name :Tesamorelin CAS :804475-66-9 Single Impurity(HPLC): 2mg/vial Amino Acid ... Read More
2017-09-27 10:11:01
China CAS:32780-32-8 Lyophilized powder PT 141 10mg/vial Peptide pt141 Bremelanotide factory

CAS:32780-32-8 Lyophilized powder PT 141 10mg/vial Peptide pt141 Bremelanotide

CAS:32780-32-8 Lyophilized powder PT 141 10mg/vial Peptide pt141 Bremelanotide Product Description Sexual Dysfunction Polypeptide Hormones Peptides PT141 Competitive Price Peptides PT141 price, PT 141, ... Read More
2017-09-27 10:11:01
China 191AA Hgh Somatropin Igf 1 Growth Hormone , Igf 1 HGH Oral Supplements factory

191AA Hgh Somatropin Igf 1 Growth Hormone , Igf 1 HGH Oral Supplements

Steroids peptides Human Growth Hormone 99% purity 191AA hgh Somatropin igtropin igf1 lr3 igf1des igtropin igf Description : Usage : Animal Pharmaceuticals Benefits of using blue top HG : . Losing Cellulite and ... Read More
2018-08-30 09:51:14
Page 1 of 4|< 1 2 3 4 >|