Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home ProductsPharmaceutical Grade Peptides

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding

I'm Online Chat Now

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding

China CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding supplier
CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding supplier CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding supplier

Large Image :  CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding

Product Details:

Place of Origin: China
Brand Name: CZG
Certification: GMP,SGS
Model Number: PEP-04

Payment & Shipping Terms:

Minimum Order Quantity: 1piece
Price: USD 55-85USD/BOX
Packaging Details: As your request or Aluminum plastic bags
Delivery Time: 1-3days after payment
Payment Terms: Western Union, MoneyGram, T/T, L/C Bitcoin
Supply Ability: 1000boxes per month
Contact Now
Detailed Product Description
Name: Sermorelin CAS: 114466-38-5
Form: Freeze-dried Powder Specification: 2mg/vial ,10vial/box
MOQ: 1vial Shipping Methods: EMS,Air Mail,Fedex,DHL,UPS
Store: Cool Dry Place Shelf Life: 2 Years
Delivery: Within 3 Days After Payment
High Light:

growth hormone peptides

,

anti aging peptides

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding

 

 

Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
EINECS: --
Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Purity: 99%,98%

 

Description:

Sermorelin , also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH.It is used as a diagnostic agent to assess growth hormone (GH) secretion. It is also used as doping agent in sports due to its correlation with increased growth of muscular and skeletal tissue. Sermorelin use is also hypothesized to improve deep rapid eye movement sleep.

 

Application:

Sermorelin is used to treat growth problems (usually in children) due to growth hormone deficiency. It works by stimulating the pituitary gland to release more natural growth hormone.

 

 

Appearance White powder
Purity(HPLC) ≥98.0%
Single Impurity(HPLC) ≤1.0%
Peptide Content(N%) ≥80.0%
Water Content(Karl Fischer) ≤6.0%
Acetate Content(HPIC) ≤12.0%
MS(ESI ) Consistent
Mass Balance 95.0~105.0%

 

 

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding

 

 

More products:

Name Spe
Melanotan 1 10mg/vial ,10vial/box
Melanotan 2 10mg/vial ,10vial/box
CJC 1295(MOD GRF 1-29) 2mg/vial ,10vial/box
cjc1295 dac 2mg/vial ,10vial/box
Sermorelin (GRF 1-29) 2mg/vial ,10vial/box
Sermorelin 5mg/vial ,10vial/box
PT 141 10mg/vial ,10vial/box
Frag HGH 176 191 2mg/vial ,10vial/box
Frag HGH 176 191 5mg/vial ,10vial/box
Ipamorelin 2mg/vial ,10vial/box
Ipamorelin 5mg/vial ,10vial/box
MGF 2mg/vial ,10vial/box
PEG MGF 2mg/vial ,10vial/box
GHRP-6 5mg/vial ,10vial/box
GHRP-2 5mg/vial ,10vial/box
Hexarelin 2mg/vial ,10vial/box
Hexarelin 5mg/vial ,10vial/box
TB-500 2mg/vial ,10vial/box
IGF-1DES 1mg 1mg/vial ,10vial/box
Oxytocin 2mg 2mg/vial ,10vial/box
epitalon 10mg/vial ,10vial/box
DSIP 2mg/vial ,10vial/box
DSIP 5mg/vial ,10vial/box
selank 2mg/vial ,10vial/box
selank 5mg/vial ,10vial/box
BPC 157 2mg/vial ,10vial/box
Gonadorelin 2mg/vial ,10vial/box
Triptorelin GNRH 2mg/vial ,10vial/box
ghrh 2mg/vial ,10vial/box
Tesamorelin 2mg/vial ,10vial/box
Follistatin 344 1mg/vial ,10vial/box
ACE031 1mg/vial ,10vial/box
GDF-8/ myostatin 1mg/vial ,10vial/box
Igf (green top ) Igf Lr3 100mcg/vial,10vial/box

 

 

Contact Details
ChangZhou General Imp&Exp Co,.LTD

Contact Person: donkonse

Send your inquiry directly to us (0 / 3000)