Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home Products

natural human growth hormone

I'm Online Chat Now

natural human growth hormone

(21)
China Muscle Growth Human Growth Hormone Powder SGS Powerful Hygetropin Hgh factory

Muscle Growth Human Growth Hormone Powder SGS Powerful Hygetropin Hgh

Ansomone Hygetropin Human Growth Hormone hyge 8iu 10iu hygetropin for Mucsle Growth Description : Usage : Animal Pharmaceuticals Benefits of using blue top HG : . Losing Cellulite and Wrinkles . Gaining muscle ... Read More
2017-09-27 10:14:04
China Pure Human Growth Hormone Powder 10iu / Vial 191AA HGH Somatropin HGH factory

Pure Human Growth Hormone Powder 10iu / Vial 191AA HGH Somatropin HGH

191AA hgh Somatropin hgh Blue top red green yellow top 10iu/vial 99% purity Description : Usage : Animal Pharmaceuticals Benefits of using blue top HG : . Losing Cellulite and Wrinkles . Gaining muscle / losing ... Read More
2017-09-27 10:14:04
China Safe Human Growth Hormone For Muscle Building High Purity Humatropin factory

Safe Human Growth Hormone For Muscle Building High Purity Humatropin

191AA hgh Somatropin Hygetropin kigtropin Nordictropin Igtropin Humatropin Description : Usage : Animal Pharmaceuticals Benefits of using blue top HG : . Losing Cellulite and Wrinkles . Gaining muscle / losing ... Read More
2017-09-27 10:14:04
China 99% Purity Somatropin Growth Hormone , Bodybuilding Natural Human Growth Hormone factory

99% Purity Somatropin Growth Hormone , Bodybuilding Natural Human Growth Hormone

Ansomone 99% purity 191AA hgh Somatropin Nordic Human Growth Hormone Nordictropin Description : Usage : Animal Pharmaceuticals Benefits of using blue top HG : . Losing Cellulite and Wrinkles . Gaining muscle / ... Read More
2017-09-27 10:14:04
China 191AA Hgh Somatropin Igf 1 Growth Hormone , Igf 1 HGH Oral Supplements factory

191AA Hgh Somatropin Igf 1 Growth Hormone , Igf 1 HGH Oral Supplements

Steroids peptides Human Growth Hormone 99% purity 191AA hgh Somatropin igtropin igf1 lr3 igf1des igtropin igf Description : Usage : Animal Pharmaceuticals Benefits of using blue top HG : . Losing Cellulite and ... Read More
2018-08-30 09:51:14
China Muscle Grain Growth Hormone Steroid , Igf1 Lr3 Igf Growth Hormone Powder factory

Muscle Grain Growth Hormone Steroid , Igf1 Lr3 Igf Growth Hormone Powder

99% min purity Build Muscle 191AA hgh igf igtropin igf1 lr3 igf1des igtropin powder Description : Usage : Animal Pharmaceuticals Benefits of using blue top HG : . Losing Cellulite and Wrinkles . Gaining muscle ... Read More
2017-09-27 10:14:04
China Weight Loss Pharmaceutical Grade Peptides White Freeze Dried Ghrp 2 Powder factory

Weight Loss Pharmaceutical Grade Peptides White Freeze Dried Ghrp 2 Powder

Basic Info. Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular Formula: C45H55N9O6 Molar Mass: 817.9 CAS number: 158861-67-7 PubChem: CID 6918245 Synonyms: Growth Hormone Releasing Peptide-2; GHRP2; GHRP ... Read More
2017-09-27 10:11:01
China CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding factory

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN... Read More
2017-09-27 10:11:01
China Anabolic Follistatin 344 Peptide Supplement FST344 Polypeptide Hormone factory

Anabolic Follistatin 344 Peptide Supplement FST344 Polypeptide Hormone

99% Polypeptide Hormone Follistatin 344 Fst344 for Muscle Building Product Decription Quick details: Appearance White to off white powder Consistent Purity(HPLC) 98% 99.0% Water Read More
2017-09-27 10:11:01
China Bodybuilding Myostatin Powder Hormone , Medicine Grade Peptides For Muscle Gain factory

Bodybuilding Myostatin Powder Hormone , Medicine Grade Peptides For Muscle Gain

GDF-8 Bodybuilding Hormone Peptide powder GDF 8 Myostatin for Muscle Growth Product Decription Quick details: Product name:Myostatin GDF-8 Purity:95% Specification:1mg/vial Appearance:White powder Certificate... Read More
2017-09-27 10:11:01
Page 1 of 3|< 1 2 3 >|